PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006843m
Common NameCARUB_v10006843mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 306aa    MW: 34713.6 Da    PI: 5.7512
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006843mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.6e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ +++++G+g +W + ++++g +R++k+c++rw++yl
  Carubv10006843m 14 KGPWSPEEDAVLKSYIEKHGTGnNWISLPQRIGIKRCGKSCRLRWLNYL 62
                     79*******************************55************97 PP

2Myb_DNA-binding36.61e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Carubv10006843m  69 GGFTDEEDYIICSLYITIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.953966IPR017930Myb domain
SuperFamilySSF466891.25E-2612109IPR009057Homeodomain-like
SMARTSM007172.7E-121364IPR001005SANT/Myb domain
PfamPF002492.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-241569IPR009057Homeodomain-like
CDDcd001673.08E-91662No hitNo description
SMARTSM007171.2E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129415.22167117IPR017930Myb domain
PfamPF002494.4E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2370117IPR009057Homeodomain-like
CDDcd001673.15E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRAPCCDKT AVKKGPWSPE EDAVLKSYIE KHGTGNNWIS LPQRIGIKRC GKSCRLRWLN  60
YLRPNLKHGG FTDEEDYIIC SLYITIGSRW SIIASQLPGR TDNDIKNYWN TRLKKKLLSK  120
QGKAFHQQLN VKLEHGTTLS SRQDQIPICH DENTKANQTL YDQVLVDPST TSFTMEEQSM  180
IKNPILESFS WEPNTVLFDI DHHDAAPSSY HHDSSPSLNS MSSSSSSTGI NSSLQMSNYS  240
TNQSEQQDMF FMTGFENLQA ELFNEIANND ETRAIGLHGN EMLYNNVLDH DISSFIDNYP  300
LYDNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285426.10.0hypothetical protein CARUB_v10006843mg
TrEMBLR0GN680.0R0GN68_9BRAS; Uncharacterized protein
STRINGAT4G37780.11e-166(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.11e-164myb domain protein 87